PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G025600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 319aa    MW: 36345.7 Da    PI: 4.6731
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G025600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.8e-102602942155
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          + +yp++++++ LA+++gL+++q+ +WF N+R ++
  Manes.12G025600.1.p 260 RWPYPTEADKKALADSTGLDQKQINNWFINQRKRH 294
                          569*****************************885 PP

2ELK23.99.7e-09214235122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ++K+ Llr +++++++Lk EFs
  Manes.12G025600.1.p 214 DIKDKLLRRFGSHISTLKLEFS 235
                          58*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-2276120IPR005540KNOX1
PfamPF037905.1E-2278118IPR005540KNOX1
SMARTSM012562.1E-22126177IPR005541KNOX2
PfamPF037911.5E-22130175IPR005541KNOX2
SMARTSM011883.2E-4214235IPR005539ELK domain
PfamPF037898.2E-7214235IPR005539ELK domain
PROSITE profilePS512139.062214234IPR005539ELK domain
PROSITE profilePS5007112.86234297IPR001356Homeobox domain
SuperFamilySSF466892.35E-19235310IPR009057Homeodomain-like
SMARTSM003895.5E-13236301IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.8E-28239299IPR009057Homeodomain-like
CDDcd000866.51E-12246297No hitNo description
PfamPF059204.0E-17254293IPR008422Homeobox KN domain
PROSITE patternPS000270272295IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDGMYGLQST ADYSDRALLS PENLILPSDY QTYLSSETYQ NWIQILVSDE LLSTTSVISE  60
SDSIAPEIPR EEDFSTLIKA KIASHPSYPR LLQAYIDCQK VGAPPEIARL LDEIRREHDL  120
CKRDTISTCL GADPELDEFM EKYCDVLAKY KSDLERPFDE AATFLNKIEI QLRDLSTGAA  180
IRSLSDEGAQ SSEEELSGGE LEVHEDQPSS EERDIKDKLL RRFGSHISTL KLEFSKKKKK  240
GKLPKEARQA LLEWWNVHYR WPYPTEADKK ALADSTGLDQ KQINNWFINQ RKRHWKPAAN  300
MQFAVTDSLS GPFFTDDQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012085436.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-148KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A067JUW20.0A0A067JUW2_JATCU; Uncharacterized protein
STRINGVIT_01s0127g00210.t011e-162(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-133KNOTTED1-like homeobox gene 6